Lumican Polyclonal antibody

• 

  WB analysis using 33000-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33000-1-AP (Lum antibody) at dilution of 1:80000 incubated at room temperature for 1.5 hours.

Lumican Polyclonal Antibody for WB, ELISA

Cat No. 33000-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

Synonyms

Keratan sulfate proteoglycan lumican, KSPG lumican, Lcn, Ldc, Lum

---

Tested Applications

• Positive WB detected in: mouse skin tissue, rat skin tissue

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33000-1-AP targets Lumican in applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2481

  Product name: Recombinant Mouse Lumican protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-338 aa of NM_008524.2

  Sequence: QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN

• Full Name: lumican
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 50-90 kDa
• GenBank Accession Number: NM_008524.2
• Gene Symbol: Lum
• Gene ID (NCBI): 17022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P51885
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lumican (LUM), a member of the small leucine-rich proteoglycan (SLRP) family, is one of the major extracellular components in interstitial collagenous matrices of the corneal stroma, aorta, skin, skeletal muscle, lung, kidney, bone, cartilage, and intervertebral discs. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins and have important effects on cell behavior. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and may exist as a glycoprotein in the connective tissues of other organs. Posttranslational modifications lumican goes through can increase its apparent molecular weight to 50-90 kDa.