Ly-6G Polyclonal antibody

• 

  WB analysis using 32346-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32346-1-AP (Ly-6G antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 32346-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 32346-1-AP (Ly-6G antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 32346-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 32346-1-AP (Ly-6G antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of mouse bone marrow cells using 32346-1-AP

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Mouse Ly-6g Polyclonal Antibody (32346-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue), or 0.25 ug APC Anti-Mouse Ly-6G/Ly-6C (Gr-1) (RB6-8C5) (APC-65140, Clone: RB6-8C5). Cells were not fixed.

Ly-6G Polyclonal Antibody for WB, IHC, FC, ELISA

Cat No. 32346-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF, FC, ELISA

Synonyms

Ly6g, Ly 6G, Ly-6G.1

---

Tested Applications

• Positive WB detected in: mouse bone marrow
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

32346-1-AP targets Ly-6G in WB, IHC, IF, FC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2609

  Product name: Recombinant Mouse Ly-6G protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-114 aa of NM_001310438.1

  Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS

• Full Name: lymphocyte antigen 6 complex, locus G
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 20-30 kDa
• GenBank Accession Number: NM_001310438.1
• Gene Symbol: Ly-6G
• Gene ID (NCBI): 546644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P35461
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Thromb Haemost; Aptamer BT200 is protective against myocardial ischemia-reperfusion injury in mice; Authors - Xinyuan Chen
mouse	IF	J Dent Sci; Neutrophil extracellular traps induced by diabetes aggravate periodontitis by inhibiting janus kinase/signal transducers and activators of transcription signaling in macrophages; Authors - Jing Wen