MAGEA10 Fusion Protein

Source

E. coli-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag7540

Synonyms

CT1.10; MAGE10; MGC10599



Product Information

Peptide Sequence SSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIKNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIIFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
(39-369 aa encoded by BC004105)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.