MAGI2 Polyclonal antibody

• 

  WB analysis using 25189-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25189-1-AP (MAGI2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25189-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25189-1-AP (MAGI2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U-87 MG using 25189-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-87 MG cells using MAGI2 antibody (25189-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

MAGI2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25189-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

ARIP1, AIP-1, AIP1, AIP 1, ACVRIP1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: U-87 MG cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

25189-1-AP targets MAGI2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18279

  Product name: Recombinant human MAGI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 563-912 aa of BC150277

  Sequence: DRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRRPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRK

• Full Name: membrane associated guanylate kinase, WW and PDZ domain containing 2
• Calculated Molecular Weight: 1455 aa, 159 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC150277
• Gene Symbol: MAGI2
• Gene ID (NCBI): 9863
• RRID: AB_3085775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UL8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAGI proteins are scaffolding proteins, belonging to the Membrane-Associated Guanylate Kinase Inverted proteins of the MAGUK family. There are three members of the MAGI subfamily, MAGI-1, MAGI-2, and MAGI-3. They are comprised of 6 PDZ domains, 2 WW domains, and 1 GUK domain. They have been proven to mediate the transport and signal transduction of various G protein-coupled receptors (GPCRs) (PMID: 29625175). The antibody is specific to MAGI2.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biol Proced Online; PRRG4 Brain-Specific Conditional Knockout Mice Display Autism Spectrum Disorder-Like Behaviors; Authors - Luxi Shen