MAGOHB Polyclonal antibody

• 

  WB analysis using 32867-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32867-1-AP (MAGOHB antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

MAGOHB Polyclonal Antibody for WB, ELISA

Cat No. 32867-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MAGOH2, Protein mago nashi homolog 2

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, Raji cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32867-1-AP targets MAGOHB in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37296

  Product name: Recombinant human MAGOHB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-116 aa of BC010905

  Sequence: MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSK

• Full Name: mago-nashi homolog B (Drosophila)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC010905
• Gene Symbol: MAGOHB
• Gene ID (NCBI): 55110
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96A72
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mago Homolog B, Exon Junction Complex Subunit (MAGOHB), is a key component of the exon junction complex (EJC), which is crucial for pre-mRNA splicing, mRNA transport, and nonsense-mediated decay (NMD). It plays a redundant role with MAGOH in the EJC and is required for proper mRNA processing and translation (PMID: 23917022). Additionally, MagoHB is involved in multiple biological processes, including neurogenesis, brain development, cell cycle regulation, and apoptosis (PMID: 37294214).