Tested Applications
| Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21633-1-AP targets MAP1B in WB, IHC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16255 Product name: Recombinant human MAP1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 414-567 aa of BC141853 Sequence: DSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEK Predict reactive species |
| Full Name | microtubule-associated protein 1B |
| Calculated Molecular Weight | 2468 aa, 271 kDa |
| Observed Molecular Weight | 320 kDa |
| GenBank Accession Number | BC141853 |
| Gene Symbol | MAP1B |
| Gene ID (NCBI) | 4131 |
| RRID | AB_10793666 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46821 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Microtubule-associated protein 1B (MAP1B) is a cytoskeleton protein which can promote microtubule assembly. Previous reports have suggested that this protein is closely involved in neuronal development based on its extensive expression in the developing brain and moderate in mature neurons. Gene disruption or knockout studies of the MAP1B gene led to a delayed development of the nervous system in mice. It includes the N-terminal heavy chain and a C-terminal light chain. The MAP1B heavy chain has a microtubule-stabilization effect, and contains an actin-binding site that may play a role in the crosslinking of actin and microtubules, a function that may be important in neurite elongation. Various isoforms around 300-350 kDa of MAP1B can be observed due to the differences in phosphorylation state. (10704485)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MAP1B antibody 21633-1-AP | Download protocol |
| IF protocol for MAP1B antibody 21633-1-AP | Download protocol |
| IHC protocol for MAP1B antibody 21633-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MAP1B Polyclonal antibody (Cat# 21633-1-AP) has 18 citations spanning journals including Nature Communications, MedComm, Advanced Science, Cell Death Discovery, EMBO Reports, Human Molecular Genetics, Cerebral Cortex, and others. Research fields cover neuronal differentiation, Parkinson's disease, ALS, microtubule dynamics, autophagy, Fragile X syndrome, spinal muscular atrophy, epilepsy, and cancer (glioblastoma, bladder, lung). Applications cited include WB, IF, IHC, and CoIP in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Nat Commun m6a methylation orchestrates IMP1 regulation of microtubules during human neuronal differentiation | ||
MedComm (2020) Leucine-rich repeat kinase 2 (LRRK2) inhibition upregulates microtubule-associated protein 1B to ameliorate lysosomal dysfunction and parkinsonism | ||
Adv Sci (Weinh) Intermediate Filament Protein BFSP1 Maintains Oocyte Asymmetric Division by Modulating Spindle Length | ||
Cell Death Discov Digital color-coded molecular barcoding reveals dysregulation of common FUS and FMRP targets in soma and neurites of ALS mutant motoneurons | ||
JCI Insight Mutations of MAP1B encoding a microtubule-associated phosphoprotein cause sensorineural hearing loss. |
Reviews
What customers say
The single available review for this antibody reports a negative experience in Western Blot using SH-SY5Y cells at a 1/1000 dilution. The reviewer noted excessive non-specific bands and no signal at the expected molecular weight, resulting in a low rating. No other reviews are currently available for this product.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Albane (Verified Customer) (02-18-2020) | A lot of bands, none at the correct size
 |
