• Featured Product
  • KD/KO Validated

MAP1B Polyclonal antibody

MAP1B Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 21633-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), CoIP, ELISA

MAP1 light chain LC1, MAP-1B, MAP1B heavy chain, Microtubule-associated protein 1B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse cerebellum tissue, human brain tissue
Positive IHC detected inmouse brain tissue, mouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21633-1-AP targets MAP1B in WB, IHC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16255

Product name: Recombinant human MAP1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 414-567 aa of BC141853

Sequence: DSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEK

Predict reactive species
Full Name microtubule-associated protein 1B
Calculated Molecular Weight 2468 aa, 271 kDa
Observed Molecular Weight 320 kDa
GenBank Accession NumberBC141853
Gene Symbol MAP1B
Gene ID (NCBI) 4131
RRIDAB_10793666
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46821
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Microtubule-associated protein 1B (MAP1B) is a cytoskeleton protein which can promote microtubule assembly. Previous reports have suggested that this protein is closely involved in neuronal development based on its extensive expression in the developing brain and moderate in mature neurons. Gene disruption or knockout studies of the MAP1B gene led to a delayed development of the nervous system in mice. It includes the N-terminal heavy chain and a C-terminal light chain. The MAP1B heavy chain has a microtubule-stabilization effect, and contains an actin-binding site that may play a role in the crosslinking of actin and microtubules, a function that may be important in neurite elongation. Various isoforms around 300-350 kDa of MAP1B can be observed due to the differences in phosphorylation state. (10704485)

Protocols

Product Specific Protocols
IF protocol for MAP1B antibody 21633-1-APDownload protocol
IHC protocol for MAP1B antibody 21633-1-APDownload protocol
WB protocol for MAP1B antibody 21633-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nat Commun

m6a methylation orchestrates IMP1 regulation of microtubules during human neuronal differentiation

Authors - Pierre Klein
humanWB

EMBO Rep

MAP1B-LC1 prevents autophagosome formation by linking syntaxin 17 to microtubules.

Authors - Kohei Arasaki
  • KD Validated
mouseWB

Cereb Cortex

eEF2K/eEF2 Pathway Controls the Excitation/Inhibition Balance and Susceptibility to Epileptic Seizures.

Authors - Christopher Heise
mouseIF

Front Cell Neurosci

Endothelin-1, over-expressed in SOD1G93A mice, aggravates injury of NSC34-hSOD1G93A cells through complicated molecular mechanism revealed by quantitative proteomics analysis

Authors - Yingzhen Zhang
mouseWB

Hum Mol Genet

Microtubule associated protein 1B dysregulates microtubule dynamics and neuronal mitochondrial transport in Spinal Muscular Atrophy.

Authors - Gamze Bora
humanWB

Cell Cycle

Depletion of JMJD5 sensitizes tumor cells to microtubule-destabilizing agents by altering microtubule stability.

Authors - Junyu Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Albane (Verified Customer) (02-18-2020)

A lot of bands, none at the correct size

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: SH-SY5Y
MAP1B Antibody Western Blot, validation (1/1000 dilution) in SH-SY5Y (Cat no:21633-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...