• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MAP1B Polyclonal antibody

MAP1B Polyclonal Antibody for IF/ICC, IF-P, FC (Intra)
Cat No. CL488-21633

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, IF-P, FC (Intra)

MAP1 light chain LC1, MAP-1B, MAP1B heavy chain, Microtubule-associated protein 1B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21633 targets MAP1B in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16255

Product name: Recombinant human MAP1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 414-567 aa of BC141853

Sequence: DSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEK

Predict reactive species
Full Name microtubule-associated protein 1B
Calculated Molecular Weight 2468 aa, 271 kDa
Observed Molecular Weight 320 kDa
GenBank Accession NumberBC141853
Gene Symbol MAP1B
Gene ID (NCBI) 4131
RRIDAB_2923747
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46821
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Microtubule-associated protein 1B (MAP1B) is a cytoskeleton protein which can promote microtubule assembly. Previous reports have suggested that this protein is closely involved in neuronal development based on its extensive expression in the developing brain and moderate in mature neurons. Gene disruption or knockout studies of the MAP1B gene led to a delayed development of the nervous system in mice. It includes the N-terminal heavy chain and a C-terminal light chain. The MAP1B heavy chain has a microtubule-stabilization effect, and contains an actin-binding site that may play a role in the crosslinking of actin and microtubules, a function that may be important in neurite elongation. Various isoforms around 300-350 kDa of MAP1B can be observed due to the differences in phosphorylation state. (10704485)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 MAP1B antibody CL488-21633Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...