MLK2 Polyclonal antibody

• 

  WB analysis using 29985-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29985-1-AP (MAP3K10 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29985-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29985-1-AP (MAP3K10 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 29985-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 29985-1-AP (MLK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 29985-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 29985-1-AP (MLK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MLK2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29985-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MAP3K10, EC:2.7.11.25, Mitogen-activated protein kinase kinase kinase 10, Mixed lineage kinase 2, MST

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

29985-1-AP targets MLK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32419

  Product name: Recombinant human MAP3K10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 476-620 aa of NM_002446

  Sequence: LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHTPIAPGFASLNEMEEFAEAED

• Full Name: mitogen-activated protein kinase kinase kinase 10
• Calculated Molecular Weight: 104KD
• Observed Molecular Weight: 104-115 kDa
• GenBank Accession Number: NM_002446
• Gene Symbol: MAP3K10
• Gene ID (NCBI): 4294
• RRID: AB_3086204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02779
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAP3K10, also named as MLK2 and MST, belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family and MAP kinase kinase kinase subfamily. MAP3K10 activates the JUN N-terminal pathway. MAP3K10 catalyzes the reaction: ATP + a protein = ADP + a phosphoprotein. MAP3K10 can be detected 104-115 kDa by phosphorylation (PMID: 23178452).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Comb Chem High Throughput Screen; Regulation of Curcumin on Follicle Initiation Rate in Diminished Ovarian Reserve; Authors - Wanjing Li