Tested Applications
| Positive WB detected in | mouse heart tissue, human heart tissue, mouse skeletal muscle tissue, rat heart tissue | 
| Positive IP detected in | mouse skeletal muscle tissue | 
| Positive IHC detected in | mouse heart tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 5 publications below | 
| IHC | See 4 publications below | 
Product Information
20184-1-AP targets MAPK12 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag14073 Product name: Recombinant human MAPK12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 216-349 aa of BC015741 Sequence: MAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVL Predict reactive species | 
                                    
| Full Name | mitogen-activated protein kinase 12 | 
| Calculated Molecular Weight | 367 aa, 42 kDa | 
| Observed Molecular Weight | 42 kDa | 
| GenBank Accession Number | BC015741 | 
| Gene Symbol | MAPK12 | 
| Gene ID (NCBI) | 6300 | 
| RRID | AB_10665949 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P53778 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MAPK12 antibody 20184-1-AP | Download protocol | 
| IP protocol for MAPK12 antibody 20184-1-AP | Download protocol | 
| WB protocol for MAPK12 antibody 20184-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Inflamm Regen SPARC activates p38γ signaling to promote PFKFB3 protein stabilization and contributes to keloid fibroblast glycolysis | ||
Tumour Biol Clinicopathological significance of p38β, p38γ, and p38δ and its biological roles in esophageal squamous cell carcinoma.
  | ||
BMC Endocr Disord The role of MAPK11/12/13/14 (p38 MAPK) protein in dopamine agonist-resistant prolactinomas. | ||
Clin Transl Oncol A retrospective analysis of the clinicopathological features and prognostic value of MAPK12 protein expression in diffuse large B-cell lymphoma | ||
J Orthop Translat Targeting the senescence-related genes MAPK12 and FOS to alleviate osteoarthritis | ||















