Product Information
CL488-82929-2 targets MAPKAPK2 in applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34196 Product name: Recombinant human MAPKAPK2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-120 aa of BC036060 Sequence: MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI Predict reactive species |
| Full Name | mitogen-activated protein kinase-activated protein kinase 2 |
| Calculated Molecular Weight | 400 aa, 46 kDa |
| Observed Molecular Weight | 42-46 kDa |
| GenBank Accession Number | BC036060 |
| Gene Symbol | MAPKAPK2 |
| Gene ID (NCBI) | 9261 |
| RRID | AB_3673139 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P49137 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
