Tested Applications
| Positive WB detected in | human brain tissue |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
11422-1-AP targets MARCKSL1 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1967 Product name: Recombinant human MARCKSL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-195 aa of BC007904 Sequence: MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE Predict reactive species |
| Full Name | MARCKS-like 1 |
| Calculated Molecular Weight | 195 aa, 20 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC007904 |
| Gene Symbol | MARCKSL1 |
| Gene ID (NCBI) | 65108 |
| RRID | AB_2140456 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49006 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MARCKS-like protein 1 (MARCKSL1) is widely expressed in nervous tissue, it is also named MARCKS-like protein (MLP) or MARCKS-related protein (MRP) and belongs to the MARCKS family, which is a highly acidic myristoylated family of PKC substrates widely distributed in diverse cell types including macrophages. The protein has a calculated molecular weight of 20 kDa and an apparent molecular weight of 42-48 kDa due to anomalous migration on SDS gels or phosphorylation. Genetic disruption of MARCKSL1 results in neural tube closure defects, events that depend on coordinated control of actin functions, cell shape, and cell migration. MARCKSL1 are thought to regulate the actin cytoskeleton and thereby participate in major cellular responses such as phagocytosis, secretion, motility, mitogenesis, and membrane trafficking.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MARCKSL1 antibody 11422-1-AP | Download protocol |
| WB protocol for MARCKSL1 antibody 11422-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Neuropharmacology FGF21 alleviates α-II-spectrin breakdown in a model of oxygen-glucose deprivation and modulates global protein phosphorylation in hippocampal neurons |











