Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, mouse kidney tissue, SH-SY5Y cells, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21552-1-AP targets MARK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16225 Product name: Recombinant human MARK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 506-611 aa of BC113869 Sequence: VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR Predict reactive species |
| Full Name | MAP/microtubule affinity-regulating kinase 1 |
| Calculated Molecular Weight | 795 aa, 89 kDa |
| Observed Molecular Weight | 85-89 kDa, 72 kDa |
| GenBank Accession Number | BC113869 |
| Gene Symbol | MARK1 |
| Gene ID (NCBI) | 4139 |
| RRID | AB_10732726 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9P0L2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MARK1, also named as MAP-microtubule affinity regulating kinase 1, which form a subfamily of the calcium/calmodulin-dependent protein kinase (CAMP) group of kinases(PMID: 22670221). It is involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. MARK1 also act as a regulator of the neuronal migration and Wnt signaling pathway. It has 3 isoforms which molecular weight is 89,84,72 kDa. This antibody may detect all of the isoforms.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MARK1 antibody 21552-1-AP | Download protocol |
| IP protocol for MARK1 antibody 21552-1-AP | Download protocol |
| WB protocol for MARK1 antibody 21552-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody Anti-MARK1 (21552-1-AP) has 14 citations spanning journals including Nature Communications, Molecular Cell, Cell Reports, Journal of Neuroscience, Free Radical Biology and Medicine, British Journal of Pharmacology, Journal of Biological Chemistry, Scientific Reports, Journal of Neuroinflammation, Neuroscience Research, PLoS One, Acta Biochimica et Biophysica Sinica, Cell Communication and Signaling, and bioRxiv. Research fields cover cancer biology, neuroscience, neuroinflammation, microtubule regulation, and protein kinase signaling.
| Species | Application | Title |
|---|---|---|
Nat Commun TNK1 is a ubiquitin-binding and 14-3-3-regulated kinase that can be targeted to block tumor growth.
| ||
Mol Cell An AMPK-Independent Signaling Pathway Downstream of the LKB1 Tumor Suppressor Controls Snail1 and Metastatic Potential.
| ||
Cell Commun Signal Doublecortin undergo nucleocytoplasmic transport via the RanGTPase signaling to promote glioma progression. | ||
J Neuroinflammation Loss of Par1b/MARK2 primes microglia during brain development and enhances their sensitivity to injury. | ||
Free Radic Biol Med Sophoridine alleviates sepsis-associated encephalopathy by inhibiting MARK4 and NLRP3 signaling. | ||
Cell Rep DIXDC1 Phosphorylation and Control of Dendritic Morphology Are Impaired by Rare Genetic Variants. |
Reviews
What customers say
The single review for this product is highly positive, rated 5 stars. The reviewer used it for Western Blot at a 1:1000 dilution and reported excellent performance, noting that even at a 10-fold dilution the antibody still produced strong, clear bands. Overall, the feedback highlights the antibody's high sensitivity and reliability for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Manish (Verified Customer) (06-09-2020) | The antibody works really well. We dilute it 10 fold and still get strong bands on western blots.
|
