Tested Applications
Positive WB detected in | mouse brain tissue, HeLa cells, SH-SY5Y cells, mouse kidney tissue, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 4 publications below |
WB | See 10 publications below |
IHC | See 1 publications below |
IP | See 2 publications below |
Product Information
21552-1-AP targets MARK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16225 Product name: Recombinant human MARK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 506-611 aa of BC113869 Sequence: VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR Predict reactive species |
Full Name | MAP/microtubule affinity-regulating kinase 1 |
Calculated Molecular Weight | 795 aa, 89 kDa |
Observed Molecular Weight | 85-89 kDa, 72 kDa |
GenBank Accession Number | BC113869 |
Gene Symbol | MARK1 |
Gene ID (NCBI) | 4139 |
RRID | AB_10732726 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9P0L2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MARK1, also named as MAP-microtubule affinity regulating kinase 1, which form a subfamily of the calcium/calmodulin-dependent protein kinase (CAMP) group of kinases(PMID: 22670221). It is involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. MARK1 also act as a regulator of the neuronal migration and Wnt signaling pathway. It has 3 isoforms which molecular weight is 89,84,72 kDa. This antibody may detect all of the isoforms.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MARK1 antibody 21552-1-AP | Download protocol |
IHC protocol for MARK1 antibody 21552-1-AP | Download protocol |
IP protocol for MARK1 antibody 21552-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell An AMPK-Independent Signaling Pathway Downstream of the LKB1 Tumor Suppressor Controls Snail1 and Metastatic Potential.
| ||
Nat Commun TNK1 is a ubiquitin-binding and 14-3-3-regulated kinase that can be targeted to block tumor growth.
| ||
Cell Rep DIXDC1 Phosphorylation and Control of Dendritic Morphology Are Impaired by Rare Genetic Variants. | ||
J Neurosci Unbiased proteomics of early Lewy body formation model implicates active microtubule affinity-regulating kinases (MARKs) in synucleinopathies. | ||
Cell Commun Signal Doublecortin undergo nucleocytoplasmic transport via the RanGTPase signaling to promote glioma progression. | ||
J Biol Chem Postsynaptic density 95 (PSD-95) serine 561 phosphorylation regulates a conformational switch and bidirectional dendritic spine structural plasticity. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Manish (Verified Customer) (06-09-2020) | The antibody works really well. We dilute it 10 fold and still get strong bands on western blots.
|