MARK1 Polyclonal antibody

• 

  WB analysis using 21552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21552-1-AP (MARK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 21552-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 21552-1-AP (MARK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 21552-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 21552-1-AP (MARK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21552-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21552-1-AP (MARK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21552-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21552-1-AP (MARK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21552-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21552-1-AP (MARK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 21552-1-AP

  IP result of anti-MARK1 (IP:21552-1-AP, 4ug; Detection:21552-1-AP 1:1000) with mouse brain tissue lysate 3440ug.

• 

  IHC staining of rat testis using 21552-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 21552-1-AP (MARK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 21552-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 21552-1-AP (MARK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

MARK1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 21552-1-AP

Publications(11)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Par1c, PAR1 homolog c, MARK, MAP/microtubule affinity-regulating kinase 1, MAP/microtubule affinity regulating kinase 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, SH-SY5Y cells, mouse kidney tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 10 publications below
• IHC: See 1 publications below
• IP: See 2 publications below

Product Information

21552-1-AP targets MARK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16225

  Product name: Recombinant human MARK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 506-611 aa of BC113869

  Sequence: VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR

• Full Name: MAP/microtubule affinity-regulating kinase 1
• Calculated Molecular Weight: 795 aa, 89 kDa
• Observed Molecular Weight: 85-89 kDa, 72 kDa
• GenBank Accession Number: BC113869
• Gene Symbol: MARK1
• Gene ID (NCBI): 4139
• RRID: AB_10732726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0L2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MARK1, also named as MAP-microtubule affinity regulating kinase 1, which form a subfamily of the calcium/calmodulin-dependent protein kinase (CAMP) group of kinases(PMID: 22670221). It is involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. MARK1 also act as a regulator of the neuronal migration and Wnt signaling pathway. It has 3 isoforms which molecular weight is 89,84,72 kDa. This antibody may detect all of the isoforms.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; An AMPK-Independent Signaling Pathway Downstream of the LKB1 Tumor Suppressor Controls Snail1 and Metastatic Potential.; Authors - Jonathan M Goodwin ; KD Validated
human	IP	Nat Commun; TNK1 is a ubiquitin-binding and 14-3-3-regulated kinase that can be targeted to block tumor growth.; Authors - Tsz-Yin Chan ; KD Validated
mouse	WB	Cell Rep; DIXDC1 Phosphorylation and Control of Dendritic Morphology Are Impaired by Rare Genetic Variants.; Authors - Vickie Kwan
Mouse	WB,IHC	J Neurosci; Unbiased proteomics of early Lewy body formation model implicates active microtubule affinity-regulating kinases (MARKs) in synucleinopathies.; Authors - Michael X Henderson
human	WB	Cell Commun Signal; Doublecortin undergo nucleocytoplasmic transport via the RanGTPase signaling to promote glioma progression.; Authors - Abiola Abdulrahman Ayanlaja
rat	WB,IP	J Biol Chem; Postsynaptic density 95 (PSD-95) serine 561 phosphorylation regulates a conformational switch and bidirectional dendritic spine structural plasticity.; Authors - Qian Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Manish (Verified Customer) (06-09-2020)

The antibody works really well. We dilute it 10 fold and still get strong bands on western blots.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000