• Featured Product
  • KD/KO Validated

MARK1 Polyclonal antibody

MARK1 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 21552-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Par1c, PAR1 homolog c, MARK, MAP/microtubule affinity-regulating kinase 1, MAP/microtubule affinity regulating kinase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HeLa cells, SH-SY5Y cells, mouse kidney tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inrat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21552-1-AP targets MARK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16225

Product name: Recombinant human MARK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 506-611 aa of BC113869

Sequence: VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR

Predict reactive species
Full Name MAP/microtubule affinity-regulating kinase 1
Calculated Molecular Weight 795 aa, 89 kDa
Observed Molecular Weight 85-89 kDa, 72 kDa
GenBank Accession NumberBC113869
Gene Symbol MARK1
Gene ID (NCBI) 4139
RRIDAB_10732726
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9P0L2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MARK1, also named as MAP-microtubule affinity regulating kinase 1, which form a subfamily of the calcium/calmodulin-dependent protein kinase (CAMP) group of kinases(PMID: 22670221). It is involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. MARK1 also act as a regulator of the neuronal migration and Wnt signaling pathway. It has 3 isoforms which molecular weight is 89,84,72 kDa. This antibody may detect all of the isoforms.

Protocols

Product Specific Protocols
IHC protocol for MARK1 antibody 21552-1-APDownload protocol
IP protocol for MARK1 antibody 21552-1-APDownload protocol
WB protocol for MARK1 antibody 21552-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

An AMPK-Independent Signaling Pathway Downstream of the LKB1 Tumor Suppressor Controls Snail1 and Metastatic Potential.

Authors - Jonathan M Goodwin
  • KD Validated
humanIP

Nat Commun

TNK1 is a ubiquitin-binding and 14-3-3-regulated kinase that can be targeted to block tumor growth.

Authors - Tsz-Yin Chan
  • KD Validated
mouseWB

Cell Rep

DIXDC1 Phosphorylation and Control of Dendritic Morphology Are Impaired by Rare Genetic Variants.

Authors - Vickie Kwan
MouseWB,IHC

J Neurosci

Unbiased proteomics of early Lewy body formation model implicates active microtubule affinity-regulating kinases (MARKs) in synucleinopathies.

Authors - Michael X Henderson
humanWB

Cell Commun Signal

Doublecortin undergo nucleocytoplasmic transport via the RanGTPase signaling to promote glioma progression.

Authors - Abiola Abdulrahman Ayanlaja
ratWB,IP

J Biol Chem

Postsynaptic density 95 (PSD-95) serine 561 phosphorylation regulates a conformational switch and bidirectional dendritic spine structural plasticity.

Authors - Qian Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Manish (Verified Customer) (06-09-2020)

The antibody works really well. We dilute it 10 fold and still get strong bands on western blots.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
Loading...
||
New chat Able
正在加载,请稍候...