MATCHF1 Polyclonal antibody

• 

  WB analysis using 24771-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24771-1-AP (MATCHF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

MATCHF1 Polyclonal Antibody for WB, ELISA

Cat No. 24771-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

MARCH I, MARCH1, MARCHF1, RING finger protein 171, RNF171

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24771-1-AP targets MATCHF1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20231

  Product name: Recombinant human MARCH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 222-272 aa of BC153124

  Sequence: QNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGGPPEVVSV

• Full Name: membrane-associated ring finger (C3HC4) 1
• Calculated Molecular Weight: 289 aa, 32 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC153124
• Gene Symbol: MARCHF1
• Gene ID (NCBI): 55016
• RRID: AB_3085754
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCQ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MARCH1 is mainly found in secondary lymphoid organs, more specifically in the endocytic pathway of dendritic cells (DCs) and B cells (11-15). MARCH1 reduces the half-life of peptide/MHC II complexes by causing their redistribution from recycling endosomes to lysosomes. MARCH1 homodimerizes and also forms heterodimers with others family members (PMID: 22508929).