MATE 2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MATE 2 Polyclonal antibody (26873-1-AP)

MATE 2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26873-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

WB, IHC, ELISA

Synonyms

SLC47A2, hMATE 2, hMATE-2, Kidney-specific H(+)/organic cation antiporter, MATE2

• 

  WB analysis of MDCK using 26873-1-AP

  MDCK cells were subjected to SDS PAGE followed by western blot with 26873-1-AP (MATE 2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 26873-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 26873-1-AP (MATE 2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MATE 2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MDCK cells
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26873-1-AP targets MATE 2 in WB, IHC, ELISA applications and shows reactivity with human, canine samples.

• Tested Reactivity: human, canine
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25472

  Product name: Recombinant human SLC47A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 469-555 aa of BC035288

  Sequence: RLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIR

• Full Name: solute carrier family 47, member 2
• Calculated Molecular Weight: 602 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC035288
• Gene Symbol: MATE2/SLC47A2
• Gene ID (NCBI): 146802
• RRID: AB_2880664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VL8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MATE 2 Polyclonal antibody (Cat# 26873-1-AP) has a total of 2 citations. These appear in Frontiers in Pharmacology and Chemistry. The cited research spans pharmacology and medicinal chemistry, covering topics such as renal transport protein regulation by traditional Chinese medicine processing and the development of platinum(IV) prodrugs with reduced ototoxicity. Both citations used the antibody for Western blot in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Pharmacol; A strategy for evaluating the impact of processing of Chinese meteria medica on meridian tropism: the influence of salt-water processing of phellodendri chinensis cortex on renal transport proteins; Authors - Yang Chen
human	WB	Chemistry; RG108-Conjugated Platinum(IV) Prodrugs: Enhanced Efficacy and Reduced Ototoxicity.; Authors - Jiyong Wu