Tested Applications
| Positive WB detected in | MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26873-1-AP targets MATE 2 in WB, ELISA applications and shows reactivity with human, Canine samples.
| Tested Reactivity | human, Canine |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25472 Product name: Recombinant human SLC47A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 469-555 aa of BC035288 Sequence: RLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIR Predict reactive species |
| Full Name | solute carrier family 47, member 2 |
| Calculated Molecular Weight | 602 aa, 65 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC035288 |
| Gene Symbol | MATE2/SLC47A2 |
| Gene ID (NCBI) | 146802 |
| RRID | AB_2880664 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86VL8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MATE 2 antibody 26873-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

