MATK Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag0128

Synonyms

CHK; CTK; DKFZp434N1212; HHYLTK; HYL; HYLTK; Lsk; MGC1708; MGC2101



Product Information

Peptide Sequence SLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEAL
(116-394 aa encoded by BC000114)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The protein was expressed as GST-tagged fusion protein by E.Coli and purified by Glutathione-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 100mM GSH.