MBL Polyclonal antibody, PBS Only

• 

  WB analysis of human plasma using 24207-1-AP (same clone as 24207-1-PBS)

  human blood was subjected to SDS PAGE followed by western blot with 24207-1-AP (MBL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24207-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 24207-1-AP (same clone as 24207-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24207-1-AP (MBL antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24207-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 24207-1-AP (same clone as 24207-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24207-1-AP (MBL antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24207-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MBL Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24207-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24207-1-PBS targets MBL in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21508

  Product name: Recombinant human MBL2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 21-248 aa of BC069338

  Sequence: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

• Full Name: mannose-binding lectin (protein C) 2, soluble (opsonic defect)
• Calculated Molecular Weight: 248 aa, 26 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC069338
• Gene Symbol: MBL2
• Gene ID (NCBI): 4153
• RRID: AB_2879458
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11226
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.