MBL Polyclonal antibody

• 

  WB analysis using 24207-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24207-1-AP (MBL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 24207-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24207-1-AP (MBL antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 24207-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24207-1-AP (MBL antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

MBL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24207-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF, ELISA

Synonyms

MBL2, COLEC1, Collectin 1, Collectin-1, HSMBPC

---

Tested Applications

• Positive WB detected in: human plasma, rat plasma
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

24207-1-AP targets MBL in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21508

  Product name: Recombinant human MBL2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 21-248 aa of BC069338

  Sequence: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

• Full Name: mannose-binding lectin (protein C) 2, soluble (opsonic defect)
• Calculated Molecular Weight: 248 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC069338
• Gene Symbol: MBL2
• Gene ID (NCBI): 4153
• RRID: AB_2879458
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11226
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; C-reactive protein (CRP) recognizes uric acid crystals and recruits proteases C1 and MASP1.; Authors - Anika Alberts
human	WB,IHC	Oncol Rep; HIF‑1α and MBP1 are associated with the progression of breast cancer cells by repressing β‑catenin transcription.; Authors - Ying Zhuang
human	WB	medRxiv; Identification of disease-specific extracellular vesicle-associated plasma protein biomarkers for Duchenne Muscular Dystrophy and Facioscapulohumeral Muscular Dystrophy; Authors - Mustafa Bilal Bayazit
	WB	Biochem Biophys Res Commun; Characterization of a silkworm UFM1 homolog in regulating Bombyx mori unfolded protein response and nucleopolyhedrovirus replication; Authors - Yiting Lu
human	IF	Adv Sci (Weinh); Exosome-Mediated Lectin Pathway and Resistin-MIF-AA Metabolism Axis Drive Immune Dysfunction in Immune Thrombocytopenia; Authors - Jin Li
rat	WB,IF	Int Immunopharmacol; Combined VEGF and bFGF loaded nanofiber membrane protects against neuronal injury and hypomyelination in a rat model of chronic cerebral hypoperfusion; Authors - Yi-Fang Wu