MBNL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MBNL3 Polyclonal antibody (24610-1-AP)

MBNL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24610-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CHCR, Cys3His CCG1 required protein, MBLX, MBLX39, MBNL3, MBXL, Muscleblind like protein 3, Protein HCHCR

• 

  WB analysis of mouse skeletal muscle using 24610-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24610-1-AP (MBNL3 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 24610-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24610-1-AP (MBNL3 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 24610-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24610-1-AP (MBNL3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 24610-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24610-1-AP (MBNL3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 24610-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24610-1-AP (MBNL3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MBNL3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24610-1-AP targets MBNL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20113

  Product name: Recombinant human MBNL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-230 aa of BC042090

  Sequence: SAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGA

• Full Name: muscleblind-like 3 (Drosophila)
• Calculated Molecular Weight: 354 aa, 39 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC042090
• Gene Symbol: MBNL3
• Gene ID (NCBI): 55796
• RRID: AB_2879637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUK0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MBNL3, also named as Muscleblind-like protein 3 or Cys3His CCG1-required protein, is a 354 amino acid protein, which contains four C3H1-type zinc fingers and belongs to the muscleblind family. MBNL3 localizes in the nucleus and is highly expressed in the placenta. MBNL3 mediates pre-mRNA alternative splicing regulation and plays a role in myotonic dystrophy pathophysiology. MBNL3 could inhibit terminal muscle differentiation, acting at approximately the time of myogenin induction.

Publications

What published studies show

The MBNL3 polyclonal antibody (Cat# 24610-1-AP) has a total of 2 citations published in Scientific Reports and Cell Cycle. The cited studies address tumor progression and metastasis in cholangiocarcinoma, where MBNL3 serves as a prognostic biomarker, and RNA regulation mechanisms involving TRIM71 binding to IMP1 for positive and negative regulation of target RNAs. Both citations involve human samples, with applications including IHC and Western blot.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Sci Rep; MBNL3 regulates tumor progression and metastasis in cholangiocarcinoma and serves as a prognostic biomarker.; Authors - Hui Zhou
human	WB	Cell Cycle; TRIM71 binds to IMP1 and is capable of positive and negative regulation of target RNAs.; Authors - Daniel J Foster