MBNL3 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 24610-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24610-1-AP (MBNL3 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of mouse skeletal muscle using 24610-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24610-1-AP (MBNL3 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of mouse skeletal muscle using 24610-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24610-1-AP (MBNL3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skeletal muscle using 24610-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24610-1-AP (MBNL3 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skeletal muscle using 24610-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24610-1-AP (MBNL3 Antibody) at dilution of 1:50 (under 10x lens).

MBNL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24610-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CHCR, Cys3His CCG1 required protein, MBLX, MBLX39, MBNL3, MBXL, Muscleblind like protein 3, Protein HCHCR

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

24610-1-AP targets MBNL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20113

  Product name: Recombinant human MBNL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-230 aa of BC042090

  Sequence: SAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGA

• Full Name: muscleblind-like 3 (Drosophila)
• Calculated Molecular Weight: 354 aa, 39 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC042090
• Gene Symbol: MBNL3
• Gene ID (NCBI): 55796
• RRID: AB_2879637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUK0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MBNL3, also named as Muscleblind-like protein 3 or Cys3His CCG1-required protein, is a 354 amino acid protein, which contains four C3H1-type zinc fingers and belongs to the muscleblind family. MBNL3 localizes in the nucleus and is highly expressed in the placenta. MBNL3 mediates pre-mRNA alternative splicing regulation and plays a role in myotonic dystrophy pathophysiology. MBNL3 could inhibit terminal muscle differentiation, acting at approximately the time of myogenin induction.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Cycle; TRIM71 binds to IMP1 and is capable of positive and negative regulation of target RNAs.; Authors - Daniel J Foster