Tested Applications
Positive WB detected in | mouse skeletal muscle tissue |
Positive IHC detected in | human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
24610-1-AP targets MBNL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20113 Product name: Recombinant human MBNL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 156-230 aa of BC042090 Sequence: SAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGA Predict reactive species |
Full Name | muscleblind-like 3 (Drosophila) |
Calculated Molecular Weight | 354 aa, 39 kDa |
Observed Molecular Weight | 38 kDa |
GenBank Accession Number | BC042090 |
Gene Symbol | MBNL3 |
Gene ID (NCBI) | 55796 |
RRID | AB_2879637 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NUK0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MBNL3, also named as Muscleblind-like protein 3 or Cys3His CCG1-required protein, is a 354 amino acid protein, which contains four C3H1-type zinc fingers and belongs to the muscleblind family. MBNL3 localizes in the nucleus and is highly expressed in the placenta. MBNL3 mediates pre-mRNA alternative splicing regulation and plays a role in myotonic dystrophy pathophysiology. MBNL3 could inhibit terminal muscle differentiation, acting at approximately the time of myogenin induction.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MBNL3 antibody 24610-1-AP | Download protocol |
IHC protocol for MBNL3 antibody 24610-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |