Tested Applications
| Positive WB detected in | HepG2 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32120-1-AP targets MBOAT4 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37237 Product name: Recombinant human MBOAT4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 262-324 aa of NM_001100916 Sequence: DDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHSRA Predict reactive species |
| Full Name | membrane bound O-acyltransferase domain containing 4 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | NM_001100916 |
| Gene Symbol | MBOAT4 |
| Gene ID (NCBI) | 619373 |
| RRID | AB_3670198 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96T53 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MBOAT4, also known as ghrelin O-acyltransferase (GOAT), is an endoplasmic reticulum enzyme that catalyzes the octanoylation of the peptide hormone ghrelin, which is essential for the binding of ghrelin to its receptor and the subsequent regulation of food intake, growth hormone secretion, and inhibition of insulin secretion (PMID: 34946685). MBOAT4 is considered a potential therapeutic target for treating disorders related to ghrelin signaling (PMID: 32564644).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MBOAT4 antibody 32120-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

