Tested Applications
Positive WB detected in | Jurkat cells, K-562 cells, mouse spleen tissue, HL-60 cells |
Positive IF/ICC detected in | U-251 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
26098-1-AP targets MBTD1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22059 Product name: Recombinant human MBTD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-40 aa of BC101736 Sequence: MGTCWGDISENVRVEVPNTDCSLPTKVFWIAGIVKLAGYN Predict reactive species |
Full Name | mbt domain containing 1 |
Calculated Molecular Weight | 628 aa, 70 kDa |
Observed Molecular Weight | 65-70 kDa |
GenBank Accession Number | BC101736 |
Gene Symbol | MBTD1 |
Gene ID (NCBI) | 54799 |
RRID | AB_2880374 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q05BQ5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MBTD1 antibody 26098-1-AP | Download protocol |
IF protocol for MBTD1 antibody 26098-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |