Tested Applications
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26471-1-AP targets MC1R in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24006 Product name: Recombinant human MC1R protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 156-243 aa of BC080622 Sequence: VTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTL Predict reactive species |
| Full Name | melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor) |
| Calculated Molecular Weight | 35 kDa |
| GenBank Accession Number | BC080622 |
| Gene Symbol | MC1R |
| Gene ID (NCBI) | 4157 |
| RRID | AB_2880529 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01726 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MC1R is a Gs-coupled melanocortin receptor that regulates melanin synthesis, UV response, and inflammatory signaling in melanocytes. Activation by α-MSH elevates cAMP to promote eumelanin production and DNA repair, enhancing photoprotection. Functional polymorphisms in MC1R underlie pigmentation diversity and significantly influence melanoma susceptibility, positioning MC1R as a central regulator of cutaneous biology and photoprotection.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MC1R antibody 26471-1-AP | Download protocol |
| IHC protocol for MC1R antibody 26471-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MC1R Polyclonal antibody (Cat# 26471-1-AP) has 3 total citations published in Advanced Healthcare Materials, Journal of Cell Science, and bioRxiv. The research fields span UVB-induced skin damage and hyperpigmentation, as well as melanocortin receptor biology—specifically the role of the E3 ubiquitin ligase MGRN1 in targeting MC1R and MC4R via transmembrane adapters. Applications cited include Western blotting and immunofluorescence in both human and mouse samples.
| Species | Application | Title |
|---|---|---|
Adv Healthc Mater A Novel FGF2-Targeted Inhibitor (N-trans-feruloyloctopamine) Suppresses UVB-Induced Skin Damage and Hyperpigmentation. | ||
J Cell Sci The E3 ubiquitin ligase MGRN1 targets melanocortin receptors MC1R and MC4R via interactions with transmembrane adapters. | ||
bioRxiv The E3 ubiquitin ligase MGRN1 targets melanocortin receptors MC1R and MC4R via interactions with transmembrane adapters |
