Tested Applications
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | A375 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
26471-1-AP targets MC1R in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag24006 Product name: Recombinant human MC1R protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 156-243 aa of BC080622 Sequence: VTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTL Predict reactive species | 
                                    
| Full Name | melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor) | 
| Calculated Molecular Weight | 35 kDa | 
| GenBank Accession Number | BC080622 | 
| Gene Symbol | MC1R | 
| Gene ID (NCBI) | 4157 | 
| RRID | AB_2880529 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q01726 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MC1R antibody 26471-1-AP | Download protocol | 
| IF protocol for MC1R antibody 26471-1-AP | Download protocol | 
| IHC protocol for MC1R antibody 26471-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 





