MC1R Polyclonal antibody

• 

  IHC staining of human brain using 26471-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26471-1-AP (MC1R Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 26471-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26471-1-AP (MC1R Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of A375 using 26471-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed A375 cells using 26471-1-AP (MC1R antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

MC1R Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 26471-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MC1 R, MC1R, Melanocortin receptor 1, MSH R, MSHR, SHEP2

---

Tested Applications

• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26471-1-AP targets MC1R in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24006

  Product name: Recombinant human MC1R protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 156-243 aa of BC080622

  Sequence: VTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTL

• Full Name: melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor)
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: BC080622
• Gene Symbol: MC1R
• Gene ID (NCBI): 4157
• RRID: AB_2880529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01726
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; The E3 ubiquitin ligase MGRN1 targets melanocortin receptors MC1R and MC4R via interactions with transmembrane adapters; Authors - Pragya Parashara