Tested Applications
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A375 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
26471-1-AP targets MC1R in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24006 Product name: Recombinant human MC1R protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 156-243 aa of BC080622 Sequence: VTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTL Predict reactive species |
Full Name | melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor) |
Calculated Molecular Weight | 35 kDa |
GenBank Accession Number | BC080622 |
Gene Symbol | MC1R |
Gene ID (NCBI) | 4157 |
RRID | AB_2880529 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q01726 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for MC1R antibody 26471-1-AP | Download protocol |
IF protocol for MC1R antibody 26471-1-AP | Download protocol |
FC protocol for MC1R antibody 26471-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |