Tested Applications
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26471-1-AP targets MC1R in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24006 Product name: Recombinant human MC1R protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 156-243 aa of BC080622 Sequence: VTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTL Predict reactive species |
| Full Name | melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor) |
| Calculated Molecular Weight | 35 kDa |
| GenBank Accession Number | BC080622 |
| Gene Symbol | MC1R |
| Gene ID (NCBI) | 4157 |
| RRID | AB_2880529 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01726 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MC1R is a Gs-coupled melanocortin receptor that regulates melanin synthesis, UV response, and inflammatory signaling in melanocytes. Activation by α-MSH elevates cAMP to promote eumelanin production and DNA repair, enhancing photoprotection. Functional polymorphisms in MC1R underlie pigmentation diversity and significantly influence melanoma susceptibility, positioning MC1R as a central regulator of cutaneous biology and photoprotection.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MC1R antibody 26471-1-AP | Download protocol |
| IHC protocol for MC1R antibody 26471-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





