Recombinant human MCFD2 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag15276
Synonyms
DKFZp686G21263; F5F8D; LMAN1IP; SDNSF
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ
(1-146 aa encoded by BC040357) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
