MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG
(1-327 aa encoded by BC107735)
Activity:
Not tested.
Endotoxin Level:
Please contact the lab for more information.
Purity:
85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation:
The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Reconstitution and Storage
Reconstitution:
Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term
storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution
volume as required (please note: the ion concentration of the final solution will
vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash
down the sides of the vial to ensure full recovery of the protein into solution.
Shipping:
The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Stability and Storage:
Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage of Reconstituted Protein:
Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer
containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw
cycles.