Tested Applications
| Positive WB detected in | A375 cells, HeLa cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 3 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
13879-1-AP targets MCOLN3 in WB, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4962 Product name: Recombinant human MCOLN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 86-285 aa of BC060765 Sequence: MVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHLYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYM Predict reactive species |
| Full Name | mucolipin 3 |
| Calculated Molecular Weight | 64 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | BC060765 |
| Gene Symbol | MCOLN3 |
| Gene ID (NCBI) | 55283 |
| RRID | AB_2142973 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TDD5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MCOLN3 (Mucolipin 3) is a member of the TRPML (Transient Receptor Potential Mucolipin) gene family and encodes a non-selective cation channel protein that is primarily localized on the membranes of endosomes and lysosomes. MCOLN3 promotes endosome acidification, regulates membrane transport and fusion, and is involved in the autophagy process. Additionally, MCOLN3 is involved in the regulation of intracellular calcium (Ca²⁺) and iron (Fe²⁺) ion homeostasis, maintains lysosomal membrane potential, promotes endosome-lysosome fusion and material transport (such as autophagy), and may also be involved in neuronal signaling and immune regulation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MCOLN3 antibody 13879-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Traffic The Ca(2+) channel TRPML3 regulates membrane trafficking and autophagy.
| ||
Cell Mol Gastroenterol Hepatol FGL2-MCOLN3-Autophagy Axis-Triggered Neutrophil Extracellular Traps Exacerbate Liver Injury in Fulminant Viral Hepatitis | ||
Phytomedicine Baicalin induces cell death of non-small cell lung cancer cells via MCOLN3-mediated lysosomal dysfunction and autophagy blockage
|

