FITC Plus Anti-Mouse MCP-1/CCL2 Rabbit Recombinant Antibody

MCP-1/CCL2 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. FITC-98028
Clone No.230483A9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Ccl2, MCP1, MCP-1, 230483A9, C-C motif chemokine 2

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inLPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98028 targets MCP-1/CCL2 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0427

Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 24-148 aa of NM-011333

Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

Predict reactive species
Full Name chemokine (C-C motif) ligand 2
GenBank Accession NumberNM-011333
Gene Symbol MCP-1/CCL2
Gene ID (NCBI) 20296
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10148
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Monocyte chemotactic protein 1 (MCP-1), also known as CCL2, is chemotactic for monocyte/macrophage, B cell, and T cell, and belongs to the CC subfamily of chemokines. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis.

Protocols

Product Specific Protocols
FC protocol for FITC Plus MCP-1/CCL2 antibody FITC-98028Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...