MCT14 Polyclonal antibody

• 

  WB analysis of Caco-2 using 26953-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 26953-1-AP (MCT14 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 26953-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 26953-1-AP (MCT14 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig kidney using 26953-1-AP

  pig kidney tissue were subjected to SDS PAGE followed by western blot with 26953-1-AP (MCT14 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

MCT14 Polyclonal Antibody for WB, ELISA

Cat No. 26953-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, pig, mouse

Applications

WB, ELISA

Synonyms

MCT 14, MCT14, Monocarboxylate transporter 14, SLC16A14

---

Tested Applications

• Positive WB detected in: Caco-2 cells, pig kidney tissue, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26953-1-AP targets MCT14 in WB, ELISA applications and shows reactivity with human, pig, mouse samples.

• Tested Reactivity: human, pig, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25315

  Product name: Recombinant human SLC16A14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 212-312 aa of BC065524

  Sequence: LSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDWYSGYFGTASLFT

• Full Name: solute carrier family 16, member 14 (monocarboxylic acid transporter 14)
• Calculated Molecular Weight: 510 aa, 56 kDa
• Observed Molecular Weight: 42-52 kDa
• GenBank Accession Number: BC065524
• Gene Symbol: MCT14
• Gene ID (NCBI): 151473
• RRID: AB_2880701
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7RTX9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.