Tested Applications
| Positive WB detected in | Caco-2 cells, pig kidney tissue, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26953-1-AP targets MCT14 in WB, ELISA applications and shows reactivity with human, pig, mouse samples.
| Tested Reactivity | human, pig, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25315 Product name: Recombinant human SLC16A14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 212-312 aa of BC065524 Sequence: LSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDWYSGYFGTASLFT Predict reactive species |
| Full Name | solute carrier family 16, member 14 (monocarboxylic acid transporter 14) |
| Calculated Molecular Weight | 510 aa, 56 kDa |
| Observed Molecular Weight | 42-52 kDa |
| GenBank Accession Number | BC065524 |
| Gene Symbol | MCT14 |
| Gene ID (NCBI) | 151473 |
| RRID | AB_2880701 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7RTX9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MCT14 antibody 26953-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





