Tested Applications
Positive WB detected in | Caco-2 cells, pig kidney tissue, SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26953-1-AP targets MCT14 in WB, ELISA applications and shows reactivity with human, pig, mouse samples.
Tested Reactivity | human, pig, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25315 Product name: Recombinant human SLC16A14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 212-312 aa of BC065524 Sequence: LSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDWYSGYFGTASLFT Predict reactive species |
Full Name | solute carrier family 16, member 14 (monocarboxylic acid transporter 14) |
Calculated Molecular Weight | 510 aa, 56 kDa |
Observed Molecular Weight | 42-52 kDa |
GenBank Accession Number | BC065524 |
Gene Symbol | MCT14 |
Gene ID (NCBI) | 151473 |
RRID | AB_2880701 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q7RTX9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MCT14 antibody 26953-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |