Product Information
84797-4-PBS targets MCT4 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag18788 Product name: Recombinant human SLC16A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 402-465 aa of BC112269 Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV Predict reactive species |
| Full Name | solute carrier family 16, member 3 (monocarboxylic acid transporter 4) |
| Calculated Molecular Weight | 465 aa, 49 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC112269 |
| Gene Symbol | MCT4 |
| Gene ID (NCBI) | 9123 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O15427 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects.

















