ME2 Polyclonal antibody

• 

  WB analysis using 24944-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 24944-1-AP

  WB result of ME2 antibody (24944-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ME2 transfected HepG2 cells.

• 

  WB analysis using 24944-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24944-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24944-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24944-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 24944-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 24944-1-AP

  IP result of anti-ME2 (IP:24944-1-AP, 4ug; Detection:24944-1-AP 1:500) with HeLa cells lysate 3200ug.

• 

  IHC staining of human pancreas cancer using 24944-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 24944-1-AP (ME2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 24944-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 24944-1-AP (ME2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 24944-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24944-1-AP (ME2 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 24944-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24944-1-AP (ME2 Antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

ME2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 24944-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

Malic enzyme 2, ME2, NAD ME

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, Jurkat cells, K-562 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human pancreas cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IP: See 2 publications below

Product Information

24944-1-AP targets ME2 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20741

  Product name: Recombinant human ME2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 136-480 aa of BC000147

  Sequence: SISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGYRIPIC

• Full Name: malic enzyme 2, NAD(+)-dependent, mitochondrial
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 54 kDa, 65 kDa
• GenBank Accession Number: BC000147
• Gene Symbol: ME2
• Gene ID (NCBI): 4200
• RRID: AB_2879813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23368
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ME2(malic enzyme 2) is also named as NAD-ME and belongs to the malic enzymes family. ME1, ME2 are important for NADPH production, lipogenesis and glutamine metabolism, but ME2 has a more profound effect. ME2 is a genome-coded mitochondrial enzyme that converts malate to pyruvate and is involved in neuronal synthesis of the neurotransmitter γ-aminobutyric acid (GABA)(PMID:15532013). This protein has 2 isoforms produced by alternative splicing with the MW of 65 kDa and 54 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma; Authors - Qifan Hu
human	WB	Cell Res; cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions.; Authors - Linchong Sun
human	WB	Cell Death Differ; SIRT5-mediated ME2 desuccinylation promotes cancer growth by enhancing mitochondrial respiration; Authors - Peng Teng ; KD Validated
human	WB,IP	Nat Commun; AKT1 phosphorylation of cytoplasmic ME2 induces a metabolic switch to glycolysis for tumorigenesis; Authors - Taiqi Chen
Human		Metabolites; Differential Inhibition of Anaplerotic Pyruvate Carboxylation and Glutaminolysis-Fueled Anabolism Underlies Distinct Toxicity of Selenium Agents in Human Lung Cancer; Authors - Teresa W-M Fan
human	WB,IP	Cell Oncol (Dordr); Sirtuin 3-mediated delactylation of malic enzyme 2 disrupts redox balance and inhibits colorectal cancer growth; Authors - Chaoqun Li