MECP2 Polyclonal antibody

• 

  WB analysis using 33824-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33824-1-AP (MECP2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

MECP2 Polyclonal Antibody for WB, ELISA

Cat No. 33824-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

AUTSX3, MeCp 2 protein, MeCp-2 protein, Methyl CpG binding protein 2, Methyl-CpG-binding protein 2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse lung tissue, rat brain tissue, rat lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33824-1-AP targets MECP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29614

  Product name: Recombinant human MECP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-218 aa of BC011612

  Sequence: MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPG

• Full Name: methyl CpG binding protein 2 (Rett syndrome)
• Calculated Molecular Weight: 52 kDa, 53 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: BC011612
• Gene Symbol: MECP2
• Gene ID (NCBI): 4204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P51608
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METHYL-CpG-BINDING PROTEIN 2(MECP2), is a chromatin-associated protein that can both activate and repress transcription. Mecp2 in the adult mouse is high in the brain, lung, and spleen, lower in heart and kidney. MECP2 takes part in the control of neuronal activity-dependent gene regulation, and this process may underlie the pathology of Rett syndrome, a severe developmental disorder with autistic phenotypes. As compared to wild-type monkeys, MECP2 transgenic monkeys exhibited a higher frequency of repetitive circular locomotion and increased stress responses, as measured by the threat-related anxiety and defensive test. Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A. Two isoforms of MECP2 exist due to alternative splicing events.This antibody reacts with the MECP2 and phosphorylated MECP2 proteins. The calculated molecular weight of MECP2 is a 52 kDa, but the post-modified MECP2 protein is about 75-80 kDa (PMID: 12160743).