MEF2C Polyclonal antibody, PBS Only

MEF2C Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 20326-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

20326-1-PBS targets MEF2C in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13255

Product name: Recombinant human MEF2C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-162 aa of BC026341

Sequence: PSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGF

Predict reactive species
Full Name myocyte enhancer factor 2C
Calculated Molecular Weight 469 aa, 51 kDa
Observed Molecular Weight45-70 kDa
GenBank Accession NumberBC026341
Gene Symbol MEF2C
Gene ID (NCBI) 4208
RRIDAB_10693772
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ06413
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MEF2C belongs to the MEF2 family. It is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. MEF2C controls cardiac morphogenesis and myogenesis, and is also involved in vascular development[PMID: 20221419]. It plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission[PMID:18599438]. It is crucial for normal neuronal development, distribution, and electrical activity in the neocortex and is necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis[PMID: 21666133]. This protein is required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. It may also be involved in neurogenesis and in the development of cortical architecture. MEF2C exists some isoforms with MV 50-52 kDa, 47 kDa, and 45 kDa, but modified MEF2C is about 55-66 kDa.

Loading...
||
New chat Able
正在加载,请稍候...