MEF2C Polyclonal antibody

• 

  WB analysis of HeLa using 20326-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20326-1-AP (MEF2C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 20326-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 20326-1-AP (MEF2C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 20326-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 20326-1-AP (MEF2C antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse small intestine using 20326-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 20326-1-AP (MEF2C antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat lymph using 20326-1-AP

  rat lymph tissue were subjected to SDS PAGE followed by western blot with 20326-1-AP (MEF2C antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 20326-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 20326-1-AP (MEF2C Antibody) at dilution of 1:50.

• 

  IHC staining of human heart using 20326-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 20326-1-AP (MEF2C Antibody) at dilution of 1:50.

• 

  IF Staining of mouse brain using 20326-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using MEF2C antibody (20326-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse brain using 20326-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using MEF2C antibody (20326-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

MEF2C Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 20326-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

MEF2C, myocyte enhancer factor 2C

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse small intestine tissue, mouse testis tissue, rat lymph tissue, SH-SY5Y cells
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20326-1-AP targets MEF2C in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13255

  Product name: Recombinant human MEF2C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-162 aa of BC026341

  Sequence: PSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGF

• Full Name: myocyte enhancer factor 2C
• Calculated Molecular Weight: 469 aa, 51 kDa
• Observed Molecular Weight: 45-70 kDa
• GenBank Accession Number: BC026341
• Gene Symbol: MEF2C
• Gene ID (NCBI): 4208
• RRID: AB_10693772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06413
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MEF2C belongs to the MEF2 family. It is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. MEF2C controls cardiac morphogenesis and myogenesis, and is also involved in vascular development[PMID: 20221419]. It plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission[PMID:18599438]. It is crucial for normal neuronal development, distribution, and electrical activity in the neocortex and is necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis[PMID: 21666133]. This protein is required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. It may also be involved in neurogenesis and in the development of cortical architecture. MEF2C exists some isoforms with MV 50-52 kDa, 47 kDa, and 45 kDa, but modified MEF2C is about 55-66 kDa.