MERTK Polyclonal antibody

MERTK Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 27900-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

c mer, EC:2.7.10.1, MER, Proto oncogene c Mer, Proto-oncogene c-Mer

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, U-937 cells, mouse testis tissue, Jurkat cells
Positive IHC detected inrat liver tissue, human lung tissue, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat liver tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27900-1-AP targets MERTK in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27540

Product name: Recombinant human MERTK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 829-999 aa of BC114918

Sequence: ELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM

Predict reactive species
Full Name c-mer proto-oncogene tyrosine kinase
Calculated Molecular Weight 999 aa, 110 kDa
Observed Molecular Weight150-180 kDa
GenBank Accession NumberBC114918
Gene Symbol MERTK
Gene ID (NCBI) 10461
RRIDAB_3086006
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ12866
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MerTK (Mer tyrosine kinase), also known as RP38, c-Eyk, c-mer, and Tyro12, was first cloned from a human B lymphoblastoid expression library (PMID:8086340) and is one of the TAM (Tyro-3, Axl, and MerTK) receptor tyrosine kinase (RTK) family (PMID:23833304). Although this RTK, like others, can promote tumor cell proliferation to some extent, MERTK primarily lends tumor cells crucial survival advantages while promoting invasion, migration and metastasis, drug resistance, and, in the innate immune system, suppressing anti-tumor immunity (PMID:32417270). The multiple MERTK species observed are likely due to posttranslational modifications (PMID: 23585477).

Protocols

Product Specific Protocols
FC protocol for MERTK antibody 27900-1-APDownload protocol
IF protocol for MERTK antibody 27900-1-APDownload protocol
IHC protocol for MERTK antibody 27900-1-APDownload protocol
WB protocol for MERTK antibody 27900-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Rep Med

Disruption of MerTK increases the efficacy of checkpoint inhibitor by enhancing ferroptosis and immune response in hepatocellular carcinoma

Authors - Shun Wang
humanWB

Front Endocrinol (Lausanne)

Downregulation of MerTK in circulating T cells of patients with non-proliferative diabetic retinopathy

Authors - Shimiao Bu
humanWB

Sci Rep

Bioinformatics analysis of Rho-signal transduction genes in postmenopausal osteoporosis and periodontitis

Authors - Jing Qi
WB

Int Immunopharmacol

Aβ impairs bone vascular homeostasis in APP/PS1 mice via disrupting the mitochondrial fission-efferocytosis axis in macrophages

Authors - Ting Liu

Food Sci Nutr

Naringenin Accelerates Diabetic Wound Healing via Regulating Macrophage M2 Polarization and Efferocytosis

Authors - Beizhi Wang
mouseWB

J Ethnopharmacol

Longan Aril polysaccharides ameliorate cognitive impairment in AD mice via restoration of the immune phagocytosis of microglia

Authors - Han Zhang
Loading...
||
New chat

Able

正在加载,请稍候...