MERTK Polyclonal antibody, PBS Only

• 

  WB analysis using 27900-1-AP (same clone as 27900-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27900-1-AP (MERTK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27900-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27900-1-AP (same clone as 27900-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27900-1-AP (MERTK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27900-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 27900-1-AP (same clone as 27900-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 27900-1-AP (MERTK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27900-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 27900-1-AP (same clone as 27900-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 27900-1-AP (MERTK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27900-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 27900-1-AP (same clone as 27900-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 27900-1-AP (MERTK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27900-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat liver using 27900-1-AP (same clone as 27900-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat liver tissue using MERTK antibody (27900-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27900-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 27900-1-AP (same clone as 27900-1-PBS)

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug MERTK Polyclonal antibody (27900-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 27900-1-PBS in a different storage buffer formulation.

MERTK Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 27900-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

c mer, EC:2.7.10.1, MER, Proto oncogene c Mer, Proto-oncogene c-Mer

---

Product Information

27900-1-PBS targets MERTK in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27540

  Product name: Recombinant human MERTK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 829-999 aa of BC114918

  Sequence: ELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM

• Full Name: c-mer proto-oncogene tyrosine kinase
• Calculated Molecular Weight: 999 aa, 110 kDa
• Observed Molecular Weight: 150-180 kDa
• GenBank Accession Number: BC114918
• Gene Symbol: MERTK
• Gene ID (NCBI): 10461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12866
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MerTK (Mer tyrosine kinase), also known as RP38, c-Eyk, c-mer, and Tyro12, was first cloned from a human B lymphoblastoid expression library (PMID:8086340) and is one of the TAM (Tyro-3, Axl, and MerTK) receptor tyrosine kinase (RTK) family (PMID:23833304). Although this RTK, like others, can promote tumor cell proliferation to some extent, MERTK primarily lends tumor cells crucial survival advantages while promoting invasion, migration and metastasis, drug resistance, and, in the innate immune system, suppressing anti-tumor immunity (PMID:32417270). The multiple MERTK species observed are likely due to posttranslational modifications (PMID: 23585477).