MERTK Polyclonal antibody

• 

  WB analysis using 27900-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27900-1-AP (MERTK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27900-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27900-1-AP (MERTK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat liver using 27900-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 27900-1-AP (MERTK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 27900-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 27900-1-AP (MERTK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 27900-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 27900-1-AP (MERTK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 27900-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27900-1-AP (MERTK antibody) at dilution of 1:800 (under 40x lens).

• 

  IF Staining of rat liver using 27900-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat liver tissue using MERTK antibody (27900-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of Jurkat using 27900-1-AP

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug MERTK Polyclonal antibody (27900-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

MERTK Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 27900-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

c mer, EC:2.7.10.1, MER, Proto oncogene c Mer, Proto-oncogene c-Mer

---

Tested Applications

• Positive WB detected in: HEK-293T cells, U-937 cells, mouse testis tissue, Jurkat cells
• Positive IHC detected in: rat liver tissue, human lung tissue, mouse lung tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat liver tissue
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 11 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

27900-1-AP targets MERTK in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27540

  Product name: Recombinant human MERTK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 829-999 aa of BC114918

  Sequence: ELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM

• Full Name: c-mer proto-oncogene tyrosine kinase
• Calculated Molecular Weight: 999 aa, 110 kDa
• Observed Molecular Weight: 150-180 kDa
• GenBank Accession Number: BC114918
• Gene Symbol: MERTK
• Gene ID (NCBI): 10461
• RRID: AB_3086006
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12866
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MerTK (Mer tyrosine kinase), also known as RP38, c-Eyk, c-mer, and Tyro12, was first cloned from a human B lymphoblastoid expression library (PMID:8086340) and is one of the TAM (Tyro-3, Axl, and MerTK) receptor tyrosine kinase (RTK) family (PMID:23833304). Although this RTK, like others, can promote tumor cell proliferation to some extent, MERTK primarily lends tumor cells crucial survival advantages while promoting invasion, migration and metastasis, drug resistance, and, in the innate immune system, suppressing anti-tumor immunity (PMID:32417270). The multiple MERTK species observed are likely due to posttranslational modifications (PMID: 23585477).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Rep Med; Disruption of MerTK increases the efficacy of checkpoint inhibitor by enhancing ferroptosis and immune response in hepatocellular carcinoma; Authors - Shun Wang
	WB	Int Immunopharmacol; Aβ impairs bone vascular homeostasis in APP/PS1 mice via disrupting the mitochondrial fission-efferocytosis axis in macrophages; Authors - Ting Liu
mouse, human	WB	Int J Biol Macromol; Omentin-1 promotes diabetic wound healing by regulating macrophage efferocytosis and M2 polarization.; Authors - Yumeng Huang
mouse	WB	Cell Mol Gastroenterol Hepatol; ATG16L1 Regulates Reparative Function of Peritoneal Macrophages During Acute Drug-induced Liver Injury.; Authors - Xun Wang
human, mouse, rat	WB,IF	Mater Today Bio; Cholesterol analogs modulate lipid nanoparticle performance for mRNA delivery after lyophilization and enable ocular disease therapy.; Authors - Ting Wang
mouse	WB	Cancer Cell; Chemotherapy triggers immune evasion by fostering LEPR(+) Kupffer cell differentiation in liver metastases.; Authors - Xuege Wang