MESP1 Polyclonal antibody

• 

  WB analysis using 32304-1-AP

  Rat skeletal muscle tissue lysates were subjected to SDS PAGE followed by western blot with 32304-1-AP (MESP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

MESP1 Polyclonal Antibody for WB, ELISA

Cat No. 32304-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

bHLHc5, Class C basic helix-loop-helix protein 5, Mesoderm posterior protein 1

---

Tested Applications

• Positive WB detected in: rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32304-1-AP targets MESP1 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38017

  Product name: Recombinant human MESP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC006219

  Sequence: MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVGRR

• Full Name: mesoderm posterior 1 homolog (mouse)
• Calculated Molecular Weight: 268 aa, 29 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC006219
• Gene Symbol: MESP1
• Gene ID (NCBI): 55897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BRJ9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MESP1 is a transiently expressed bHLH transcription factor that serves as a master regulator of mesoderm formation and cardiac lineage specification during early embryogenesis. By activating core cardiovascular transcriptional networks and promoting mesodermal cell migration, MESP1 establishes the foundation for heart development. Perturbation of MESP1 function leads to defective mesoderm patterning and congenital heart disease, underscoring its pivotal role in early developmental programming.