Tested Applications
| Positive WB detected in | rat skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32304-1-AP targets MESP1 in WB, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38017 Product name: Recombinant human MESP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC006219 Sequence: MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVGRR Predict reactive species |
| Full Name | mesoderm posterior 1 homolog (mouse) |
| Calculated Molecular Weight | 268 aa, 29 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC006219 |
| Gene Symbol | MESP1 |
| Gene ID (NCBI) | 55897 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9BRJ9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MESP1 is a transiently expressed bHLH transcription factor that serves as a master regulator of mesoderm formation and cardiac lineage specification during early embryogenesis. By activating core cardiovascular transcriptional networks and promoting mesodermal cell migration, MESP1 establishes the foundation for heart development. Perturbation of MESP1 function leads to defective mesoderm patterning and congenital heart disease, underscoring its pivotal role in early developmental programming.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MESP1 antibody 32304-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

