METAP1 Polyclonal antibody

METAP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 28702-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Peptidase M 1, MetAP 1, MAP 1, KIAA0094

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A375 cells, HCT-116 cells, HUVEC cells, HeLa cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28702-1-AP targets METAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29828

Product name: Recombinant human METAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-167 aa of NM_015143

Sequence: MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEID

Predict reactive species
Full Name methionyl aminopeptidase 1
Calculated Molecular Weight 43 kDa
Observed Molecular Weight40-43 kDa
GenBank Accession NumberNM_015143
Gene Symbol METAP1
Gene ID (NCBI) 23173
RRIDAB_3086080
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP53582
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METAP1 (methionyl aminopeptidase 1), also known as MAP1A or MetAP1A, is expected to be located in cytosol and widely expressed in esophagus and testis. The calculated molecular weight of METAP1 is 43 kDa. METAP1 is expected to have aminopeptidase activity and metallo-exopeptidase activity. It is also involved in platelet aggregation. At the same time, HsMetAP1 participates in co-translation to remove N- terminal methionine from newborn protein. Studies have shown that when HsMetAP1 is knocked down by gene-specific siRNA, cells show slow progress in G(2)/M phase, which is similar to cells treated with MetAP1 inhibitors. Importantly, MetAP1 inhibitors can induce apoptosis of leukemia cell lines, which may be the result of their interference with G(2)/M checkpoint. Therefore, it is necessary for normal cell cycle, especially in G(2)/M phase of cell cycle, and it can be used as a promising target for discovering and developing new anticancer drugs (PMID: 17114291).

Protocols

Product Specific Protocols
WB protocol for METAP1 antibody 28702-1-APDownload protocol
IHC protocol for METAP1 antibody 28702-1-APDownload protocol
IF protocol for METAP1 antibody 28702-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...