METTL6 Monoclonal antibody

• 

  WB analysis using 68400-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68400-1-Ig (METTL6 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control.

• 

  IHC staining of human breast cancer using 68400-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 68400-1-Ig (METTL6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 68400-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68400-1-Ig (METTL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 68400-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68400-1-Ig (METTL6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 68400-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 68400-1-Ig (METTL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

METTL6 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68400-1-Ig

Clone No.1C7D4

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

1C7D4, EC:2.1.1.-, hMETTL6, methyltransferase like 6, Methyltransferase-like protein 6

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human breast cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68400-1-Ig targets METTL6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9714

  Product name: Recombinant human METTL6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC022400

  Sequence: MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVN

• Full Name: methyltransferase like 6
• Calculated Molecular Weight: 255 aa, 30 kDa
• Observed Molecular Weight: 30-32 kDa
• GenBank Accession Number: BC022400
• Gene Symbol: METTL6
• Gene ID (NCBI): 131965
• RRID: AB_3085117
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TCB7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Methyltransferase-like protein 6 (METTL6) belongs to the METL family. METTL6 is as a crucial regulator of tumor cell growth, and METTL6 is a bona fide transfer RNA (tRNA) methyltransferase, catalyzing the formation of 3-methylcytidine at C32 of specific serine tRNA isoacceptors (PMID:32923617). METTL6 is a member of the RNA methyltransferase family that has been identified in many cancers. The mRNA expression levels of METTL6 were significantly upregulated in HCC tumor tissues compared to that in adjacent non tumor tissues. CRISPR/Cas9 mediated knockout of METTL6 in hepatocellular carcinoma cell lines remarkably inhibited colony formation, cell proliferation, cell migration, cell invasion and cell attachment ability (PMID:34913069).