MFAP4 Polyclonal antibody, PBS Only

• 

  WB analysis of human kidney using 17661-1-AP (same clone as 17661-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 17661-1-AP (MFAP4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat lung using 17661-1-AP (same clone as 17661-1-PBS)

  rat lung tissue were subjected to SDS PAGE followed by western blot with 17661-1-AP (MFAP4 Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 17661-1-AP (same clone as 17661-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 17661-1-AP (MFAP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 17661-1-AP (same clone as 17661-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 17661-1-AP (MFAP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 17661-1-AP (MFAP4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17661-1-AP (same clone as 17661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17661-1-AP (MFAP4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17661-1-PBS in a different storage buffer formulation.

MFAP4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17661-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Microfibril-associated glycoprotein 4

---

Product Information

17661-1-PBS targets MFAP4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11920

  Product name: Recombinant human MFAP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-255 aa of BC062415

  Sequence: MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

• Full Name: microfibrillar-associated protein 4
• Calculated Molecular Weight: 255 aa, 29 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC062415
• Gene Symbol: MFAP4
• Gene ID (NCBI): 4239
• RRID: AB_2142355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55083
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Microfibrillar-associated protein 4 (MFAP4) is a extracellular matrix glycoprotein containing a fibrinogen C-terminal domain and a N-terminal located integrin-binding motif. It could be involved in calcium-dependent cell adhesion or intercellular interactions. MFAP4 gene is commonly deleted in Smith-Magenis syndrome patients. (PMID: 7633408; 16867155; 10542261; 18322703)