MFN2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MFN2 Polyclonal antibody (12186-1-AP)

• Featured Product
• KD/KO Validated

The MFN2 polyclonal antibody (12186-1-AP) is one of the most highly cited MFN2 antibodies in the market. It is suitable for WB, IHC, IP, ELISA and has been referenced in over 666 publications.

Cat No. 12186-1-AP Copied!

Publications (666)

Reviews (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

CPRP1, EC:3.6.5.-, HSG, KIAA0214, MARF

• 

  WB analysis using 12186-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12186-1-AP (MFN2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12186-1-AP

  WB result of MFN2 antibody (12186-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MFN2 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12186-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12186-1-AP (MFN2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12186-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12186-1-AP (MFN2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 12186-1-AP

  IP result of anti-MFN2 (IP:12186-1-AP, 4ug; Detection:12186-1-AP 1:10000) with mouse kidney tissue lysate 2160 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12186-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12186-1-AP (MFN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12186-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12186-1-AP (MFN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 12186-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12186-1-AP (MFN2 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MFN2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, mouse kidney tissue, rat brain tissue, rat heart tissue, mouse liver tissue, rat kidney tissue, rat liver tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human colon cancer tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12186-1-AP targets MFN2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, zebrafish, goat, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2845

  Product name: Recombinant human MFN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-353 aa of BC017061

  Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA

• Full Name: mitofusin 2
• Calculated Molecular Weight: 757 aa, 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC017061
• Gene Symbol: MFN2
• Gene ID (NCBI): 9927
• ENSEMBL Gene ID: ENSG00000116688
• RRID: AB_2266320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95140
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MFN2, also named as CPRP1 and KIAA0214, belongs to the mitofusin family. It is an Essential transmembrane GTPase, which mediates mitochondrial fusion. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression of MFN2 induces the formation of mitochondrial networks. It plays an important role in the regulation of vascular smooth muscle cell proliferation. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 2A2 (CMT2A2). Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 6 (CMT6). Ubiquitinated forms of Mfn2 (mono- and polyubiquitinated) are present during mitophagy.

Publications

What published studies show

Anti-MFN2 antibody (Cat# 12186-1-AP) has accumulated 666 citations published in prestigious journals including Nature, Science, Cell, Nature Communications, Nature Neuroscience, Autophagy, Redox Biology, Cell Death & Disease, Free Radical Biology and Medicine, Theranostics, Oncogene, and EMBO Journal. Associated research fields encompass mitochondrial dynamics, mitophagy, cardiac hypertrophy, neurodegenerative diseases, cancer biology, diabetic complications, ferroptosis, oxidative stress, ischemia-reperfusion injury, and inflammatory responses.

Automatically generated from the 666 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Cellular ATP demand creates metabolically distinct subpopulations of mitochondria; Authors - Keun Woo Ryu ; KO Validated
human	WB	Science; Endosomal lipid signaling reshapes the endoplasmic reticulum to control mitochondrial function; Authors - Wonyul Jang
mouse	WB	Cell; Mitocytosis, a migrasome-mediated mitochondrial quality-control process.; Authors - Haifeng Jiao ; KD Validated
mouse	WB	Cell Metab; Mitochondrial Dynamics Is Critical for the Full Pluripotency and Embryonic Developmental Potential of Pluripotent Stem Cells.; Authors - Xiuying Zhong
mouse	WB	Cell Metab; O-GlcNAcylation-mediated endothelial metabolic memory contributes to cardiac damage via small extracellular vesicles; Authors - Mingge Ding
mouse	WB	Cell Res; DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.; Authors - Pengli Zheng

Reviews

4.7 out of 5

10 verified customer reviews

What customers say

All 10 reviews rate this antibody 4–5 stars. Most users applied it for Western Blot, with several also confirming IHC, IF, and IP performance. It produces a clean band at the expected ~86 kDa across diverse cell types including fibroblasts, A549, adipocytes, corneal cells, and mouse brain lysate. Recommended dilutions range from 1:500 to 1:5000. One reviewer noted mild non-specific binding but found it acceptable overall. Users describe it as reliable, efficient, and highly recommended for detecting endogenous Mfn2.

Automatically generated from the 10 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Manon (Verified Customer) (01-23-2026)

Works well for WB, size around 86kDa

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Fibroblasts

Vignesh (Verified Customer) (11-18-2025)

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: 231 cells

Robert (Verified Customer) (09-24-2025)

Decent, used for western, a little bit of non-specific binding, but gets the job done

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HCEC

Sneha (Verified Customer) (09-24-2025)

GOOD

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Flow Cytometry, Cell culture
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: ARPE-19

Michael (Verified Customer) (09-23-2025)

Very good for my westerns

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: Corneal cells

Henry (Verified Customer) (09-23-2025)

Works efficiently highly recommended

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation
• Primary Antibody Dilution: 1:2500
• Cell Tissue Type: MIOM1 PBMCS

S (Verified Customer) (09-23-2024)

Good

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: A549

MFN2 Antibody Western Blot validation (1000 dilution) in A549 (Cat no:12186-1-AP)

Nin (Verified Customer) (02-27-2023)

A reliable Ab to detect endogenous Mfn2

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: mouse brain lysate

MFN2 Antibody Western Blot validation (1:3000 dilution) in mouse brain lysate (Cat no:12186-1-AP)

Mi (Verified Customer) (02-21-2023)

This antibody works pretty well in adipocytes, we got a single and clean band at the expected size.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: adipocytes

Julia (Verified Customer) (11-16-2018)

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Hek293 cells