• Featured Product
  • KD/KO Validated

MFN2 Polyclonal antibody

The MFN2 polyclonal antibody (12186-1-AP) is one of the most highly cited MFN2 antibodies in the market. It is suitable for WB, IHC, IP, ELISA and has been referenced in over 464 publications.
Cat No. 12186-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF, IP, CoIP, ELISA

CPRP1, EC:3.6.5.-, HSG, KIAA0214, MARF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HeLa cells, mouse kidney tissue, rat brain tissue, rat heart tissue, mouse liver tissue, rat kidney tissue, rat liver tissue
Positive IP detected inmouse kidney tissue
Positive IHC detected inhuman colon cancer tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12186-1-AP targets MFN2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, zebrafish, bovine, goat, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2845

Product name: Recombinant human MFN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-353 aa of BC017061

Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA

Predict reactive species
Full Name mitofusin 2
Calculated Molecular Weight 757 aa, 86 kDa
Observed Molecular Weight 86 kDa
GenBank Accession NumberBC017061
Gene Symbol MFN2
Gene ID (NCBI) 9927
ENSEMBL Gene IDENSG00000116688
RRIDAB_2266320
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95140
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MFN2, also named as CPRP1 and KIAA0214, belongs to the mitofusin family. It is an Essential transmembrane GTPase, which mediates mitochondrial fusion. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression of MFN2 induces the formation of mitochondrial networks. It plays an important role in the regulation of vascular smooth muscle cell proliferation. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 2A2 (CMT2A2). Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 6 (CMT6). Ubiquitinated forms of Mfn2 (mono- and polyubiquitinated) are present during mitophagy.

Protocols

Product Specific Protocols
IHC protocol for MFN2 antibody 12186-1-APDownload protocol
IP protocol for MFN2 antibody 12186-1-APDownload protocol
WB protocol for MFN2 antibody 12186-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nature

Cellular ATP demand creates metabolically distinct subpopulations of mitochondria

Authors - Keun Woo Ryu
  • KO Validated
mouseWB

Cell

Mitocytosis, a migrasome-mediated mitochondrial quality-control process.

Authors - Haifeng Jiao
  • KD Validated
mouseWB

Cell Metab

Mitochondrial Dynamics Is Critical for the Full Pluripotency and Embryonic Developmental Potential of Pluripotent Stem Cells.

Authors - Xiuying Zhong
mouseWB

ACS Cent Sci

Macrophage Inactivation by Small Molecule Wedelolactone via Targeting sEH for the Treatment of LPS-Induced Acute Lung Injury

Authors - Juan Zhang
mouse,humanWB,IF

Nat Commun

Engineered hypoxia-responsive albumin nanoparticles mediating mitophagy regulation for cancer therapy

Authors - Wenyan Wang
mouseWB

Mol Cell

Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation

Authors - Chuanlong Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Robert (Verified Customer) (09-24-2025)

Decent, used for western, a little bit of non-specific binding, but gets the job done

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HCEC
FH

Sneha (Verified Customer) (09-24-2025)

GOOD

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Flow Cytometry, Cell culture
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: ARPE-19
FH

Michael (Verified Customer) (09-23-2025)

Very good for my westerns

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Corneal cells
FH

Henry (Verified Customer) (09-23-2025)

Works efficiently highly recommended

  • Applications: Western Blot, Immunohistochemistry, Immunoprecipitation
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: MIOM1 PBMCS
FH

S (Verified Customer) (09-23-2024)

Good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: A549
MFN2 Antibody Western Blot validation (1000 dilution) in A549 (Cat no:12186-1-AP)
FH

Nin (Verified Customer) (02-27-2023)

A reliable Ab to detect endogenous Mfn2

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mouse brain lysate
MFN2 Antibody Western Blot validation (1:3000 dilution) in mouse brain lysate (Cat no:12186-1-AP)
FH

Mi (Verified Customer) (02-21-2023)

This antibody works pretty well in adipocytes, we got a single and clean band at the expected size.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: adipocytes
FH

Julia (Verified Customer) (11-16-2018)

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hek293 cells
Loading...
||
New chat Able
正在加载,请稍候...