MFSD2 Polyclonal antibody

• 

  WB analysis of HepG2 using 25498-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25498-1-AP (MFSD2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 25498-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25498-1-AP (MFSD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 25498-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25498-1-AP (MFSD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 25498-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25498-1-AP (MFSD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 25498-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25498-1-AP (MFSD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 25498-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25498-1-AP (MFSD2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 25498-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25498-1-AP (MFSD2 Antibody) at dilution of 1:50 (under 40x lens).

MFSD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25498-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

FP1147, HMFN0656, MFSD2, MFSD2A, PP10484, PP9177, RP3 342P20.1, UNQ300/PRO341

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IHC detected in: human placenta tissue, human testis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

25498-1-AP targets MFSD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22232

  Product name: Recombinant human MFSD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 453-530 aa of BC092414

  Sequence: AGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL

• Full Name: major facilitator superfamily domain containing 2
• Calculated Molecular Weight: 543 aa, 60 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC092414
• Gene Symbol: MFSD2
• Gene ID (NCBI): 84879
• RRID: AB_2880103
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NA29
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MFSD2, also named as MFSD2A, belongs to a large family of presumptive carbohydrate transporters with 10-12 membrane-spanning domains, is located at chromosomal position 1p34.2, and is conserved in evolution. It plays a role in thermogenesis via beta-adrenergic signaling pathway. It may be the main plasma membrane tunicamycin transporter. MFSD2 has three isoforms with MW 50 kDa and 59-60 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC,IF	Neuro Oncol; Wnt signaling regulates MFSD2A-dependent drug delivery through endothelial transcytosis in glioma; Authors - Yuan Xie
human	WB	bioRxiv; Modulation of blood-tumor barrier transcriptional programs improves intra-tumoral drug delivery and potentiates chemotherapy in GBM; Authors - Jorge L Jimenez-Macias
human	WB	Sci Adv; Modulation of blood-tumor barrier transcriptional programs improves intratumoral drug delivery and potentiates chemotherapy in GBM; Authors - Jorge L Jimenez-Macias