Tested Applications
Positive WB detected in | HepG2 cells |
Positive IHC detected in | human placenta tissue, human testis tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
25498-1-AP targets MFSD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22232 Product name: Recombinant human MFSD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 453-530 aa of BC092414 Sequence: AGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL Predict reactive species |
Full Name | major facilitator superfamily domain containing 2 |
Calculated Molecular Weight | 543 aa, 60 kDa |
Observed Molecular Weight | 62 kDa |
GenBank Accession Number | BC092414 |
Gene Symbol | MFSD2 |
Gene ID (NCBI) | 84879 |
RRID | AB_2880103 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NA29 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MFSD2, also named as MFSD2A, belongs to a large family of presumptive carbohydrate transporters with 10-12 membrane-spanning domains, is located at chromosomal position 1p34.2, and is conserved in evolution. It plays a role in thermogenesis via beta-adrenergic signaling pathway. It may be the main plasma membrane tunicamycin transporter. MFSD2 has three isoforms with MW 50 kDa and 59-60 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MFSD2 antibody 25498-1-AP | Download protocol |
IHC protocol for MFSD2 antibody 25498-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Neuro Oncol Wnt signaling regulates MFSD2A-dependent drug delivery through endothelial transcytosis in glioma | ||
bioRxiv Modulation of blood-tumor barrier transcriptional programs improves intra-tumoral drug delivery and potentiates chemotherapy in GBM | ||
Sci Adv Modulation of blood-tumor barrier transcriptional programs improves intratumoral drug delivery and potentiates chemotherapy in GBM |