MFSD2 Polyclonal antibody, PBS Only

• 

  WB analysis using 30555-1-AP (same clone as 30555-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30555-1-AP (MFSD2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30555-1-PBS in a different storage buffer formulation.

MFSD2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30555-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

NLS1, MFSD2a, Major facilitator superfamily domain-containing protein 2A, HsMFSD2A, HMFN0656

---

Product Information

30555-1-PBS targets MFSD2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33064

  Product name: Recombinant human MFSD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 170-219 aa of BC092414

  Sequence: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS

• Full Name: major facilitator superfamily domain containing 2
• Calculated Molecular Weight: 543 aa, 60 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC092414
• Gene Symbol: MFSD2
• Gene ID (NCBI): 84879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NA29
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MFSD2 is a transmembrane protein and sodium-dependent lysophosphatidylcholine transporter. MFSD2 is involved in the establishment of the blood-brain barrier and is required for brain growth and function.