MGAT2 Polyclonal antibody, PBS Only

• 

  WB analysis of human liver using 15772-1-AP (same clone as 15772-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 15772-1-AP (MGAT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15772-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 15772-1-AP (same clone as 15772-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15772-1-AP (MGAT2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15772-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15772-1-AP (same clone as 15772-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15772-1-AP (MGAT2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15772-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15772-1-AP (same clone as 15772-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15772-1-AP (MGAT2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15772-1-PBS in a different storage buffer formulation.

MGAT2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15772-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15772-1-PBS targets MGAT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8423

  Product name: Recombinant human MGAT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 101-447 aa of BC006390

  Sequence: DQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVVAISPPRKNGGWGDIRDHELCKSYRRLQ

• Full Name: mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
• Calculated Molecular Weight: 447 aa, 52 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC006390
• Gene Symbol: MGAT2
• Gene ID (NCBI): 4247
• RRID: AB_2142907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q10469
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.