Use Able AI chat for product recommendations

MGAT4A Polyclonal antibody

MGAT4A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25109-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

GNT IVA, Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form, EC:2.4.1.145, GlcNAc T IVa

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, THP-1 cells
Positive IHC detected inmouse small intestine tissue, human breast cancer tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25109-1-AP targets MGAT4A in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18956

Product name: Recombinant human MGAT4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 395-505 aa of BC127107

Sequence: EVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSL

Predict reactive species
Full Name mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A
Calculated Molecular Weight 535 aa, 62 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC127107
Gene Symbol MGAT4A
Gene ID (NCBI) 11320
RRIDAB_2879901
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UM21
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MGAT4A (alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase A) is a key enzyme that catalyzes the formation of a specific branch on N-linked glycans (the transfer of β1,4-GlcNAc to the α1,3-mannose arm), belonging to the glycosyltransferase family. It is responsible for trimming and remodeling N-glycans in the Golgi apparatus to generate tissue- and disease-specific N-glycan structures. MGAT4A and MGAT4B are isoenzymes that catalyze the transfer of GlcNAc via a β1-4 linkage to the α1-3 linked mannose of the N-glycan core, thereby regulating glycoprotein maturation and function. This enzyme is involved in immunoglobulin G glycosylation, insulin receptor signaling, and neural cell adhesion molecule function. Deficiency of MGAT4A leads to decreased IgG galactosylation and enhanced pro-inflammatory activity, which is associated with an increased risk of autoimmune diseases such as rheumatoid arthritis and IgA nephropathy. Concurrently, it affects insulin secretion in pancreatic β-cells, highlighting its dual role in metabolic regulation and immune homeostasis.

Protocols

Product Specific Protocols
IHC protocol for MGAT4A antibody 25109-1-APDownload protocol
WB protocol for MGAT4A antibody 25109-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Biochem Biophys Rep

Development and validation of a glycosyltransferase-associated prognostic model for melanoma and characterization of the tumor immune microenvironment using single-cell sequencing data.

Authors - Ma Jia-xin
mouse,humanWB,IHC

Biochim Biophys Acta Mol Cell Res

N-glycosylation by N-acetylglucosaminyltransferase IVa enhances the interaction of integrin β1 with vimentin and promotes hepatocellular carcinoma cell motility

Authors - Depeng Yang
humanWB

iScience

Self-regulation of MGAT4A and MGAT4B activity toward glycoproteins through interaction of lectin domain with their own N-glycans

Authors - Naoko Osada
Loading...
||
New chat

Able

正在加载,请稍候...