Product Information
83199-1-PBS targets MIF in Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0574 Product name: Recombinant mouse MIF protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 2-115 aa of NM_010798.2 Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA Predict reactive species |
| Full Name | macrophage migration inhibitory factor |
| Calculated Molecular Weight | 13KD |
| GenBank Accession Number | NM_010798.2 |
| Gene Symbol | Mif |
| Gene ID (NCBI) | 17319 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P34884 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
