CCL3/MIP-1 alpha Polyclonal antibody, PBS Only

CCL3/MIP-1 alpha Polyclonal Antibody for WB, Indirect ELISA
Cat No. 27441-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

CCL3, MIP 1 alpha/CCL3, MIP-1 alpha, MIP-1 Alpha/CCL3, C C motif chemokine 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

27441-1-PBS targets CCL3/MIP-1 alpha in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26764

Product name: Recombinant human CCL3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-92 aa of BC071834

Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Predict reactive species
Full Name chemokine (C-C motif) ligand 3
Calculated Molecular Weight 92 aa, 10 kDa
Observed Molecular Weight10 kDa
GenBank Accession NumberBC071834
Gene Symbol CCL3/MIP-1 alpha
Gene ID (NCBI) 6348
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10147
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Chemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells.

Loading...
||
New chat Able
正在加载,请稍候...