Product Information
60772-1-PBS targets MITF as part of a matched antibody pair:
MP51100-1: 60772-1-PBS capture and 60772-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14651 Product name: Recombinant human MITF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-91 aa of BC012503 Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ Predict reactive species |
Full Name | microphthalmia-associated transcription factor |
Calculated Molecular Weight | 91 aa, 10 kDa, 59 kDa |
GenBank Accession Number | BC012503 |
Gene Symbol | MITF |
Gene ID (NCBI) | 4286 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O75030 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |