Product Information
83803-2-PBS targets MITF in IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag3679 Product name: Recombinant human MITF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC012503 Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ Predict reactive species |
Full Name | microphthalmia-associated transcription factor |
Calculated Molecular Weight | 91 aa, 10 kDa, 59 kDa |
Observed Molecular Weight | 60-65 kDa |
GenBank Accession Number | BC012503 |
Gene Symbol | MITF |
Gene ID (NCBI) | 4286 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O75030 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases (PMID:22523078). Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells (PMID: 10578055).