MITF Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HepG2 using 83803-2-RR (same clone as 83803-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MITF antibody (83803-2-RR, Clone: 240815E7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83803-2-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 83803-2-RR (same clone as 83803-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using MITF antibody (83803-2-RR, Clone: 240815E7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83803-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83803-2-RR (same clone as 83803-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MITF antibody (83803-2-RR, Clone: 240815E7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83803-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83803-2-RR (same clone as 83803-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug MITF Recombinant antibody (83803-2-RR, Clone:240815E7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83803-2-PBS in a different storage buffer formulation.

• 

  ChIP experiment of K-562 using 83803-2-RR (same clone as 83803-2-PBS)

  Chromatin was prepared from K-562 cells. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 20 µg of cross-linked chromatin, 5 µg of MITF (83803-2-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 83803-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83803-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83803-2-PBS against Human MITF was performed. The affinity constant is 3.09 nM.

• 

  Affinity and Kinetic Characterization of 83803-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83803-2-RR against Human MITF were performed. The affinity constant is 31.9 pM.

MITF Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR

Cat No. 83803-2-PBS

Clone No.240815E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR

Synonyms

240815E7, bHLHe32, Class E basic helix-loop-helix protein 32, MI, Microphthalmia-associated transcription factor

---

Product Information

83803-2-PBS targets MITF in IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3679

  Product name: Recombinant human MITF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC012503

  Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ

• Full Name: microphthalmia-associated transcription factor
• Calculated Molecular Weight: 91 aa, 10 kDa, 59 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC012503
• Gene Symbol: MITF
• Gene ID (NCBI): 4286
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75030
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases (PMID:22523078). Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells (PMID: 10578055).