NIFK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NIFK Polyclonal antibody (12615-1-AP)

NIFK Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 12615-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

MKI67IP, hNIFK, MKI67 FHA domain-interacting nucleolar phosphoprotein, NOPP34, Nucleolar protein interacting with the FHA domain of pKI-67

• 

  WB analysis using 12615-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12615-1-AP (NIFK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12615-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12615-1-AP (MKI67IP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12615-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12615-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 12615-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 12615-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 12615-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 12615-1-AP (NIFK antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 12615-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.4 ug NIFK Polyclonal antibody (12615-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NIFK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells
• Positive IHC detected in: human liver cancer tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12615-1-AP targets NIFK in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3284

  Product name: Recombinant human MKI67IP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 5-293 aa of BC024238

  Sequence: SGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ

• Full Name: MKI67 (FHA domain) interacting nucleolar phosphoprotein
• Calculated Molecular Weight: 293 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC024238
• Gene Symbol: NIFK
• Gene ID (NCBI): 84365
• RRID: AB_2142384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NIFK Polyclonal antibody (Cat# 12615-1-AP) has 3 citations published in Molecular Cell, iScience, and Journal of Cell Science. The associated research fields include viral infection and antiviral RNA biology, posttranscriptional regulation in human pluripotent stem cells, and stress- and mitosis-dependent protein phosphorylation.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Alphavirus infection triggers selective cytoplasmic translocation of nuclear RBPs with moonlighting antiviral roles; Authors - Wael Kamel
human	WB	iScience; Multi-omics approach reveals posttranscriptionally regulated genes are essential for human pluripotent stem cells.; Authors - Mio Iwasaki
		J Cell Sci; Stress- and mitosis-dependent phosphorylation of NIFK on Ser247.; Authors - Sibylle Schleich