NIFK Polyclonal antibody

• 

  WB analysis using 12615-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12615-1-AP (NIFK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12615-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12615-1-AP (MKI67IP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 12615-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 12615-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 12615-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 12615-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 12615-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 12615-1-AP (NIFK antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of MCF-7 using 12615-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.4 ug NIFK Polyclonal antibody (12615-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

NIFK Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 12615-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

MKI67IP, hNIFK, MKI67 FHA domain-interacting nucleolar phosphoprotein, NOPP34, Nucleolar protein interacting with the FHA domain of pKI-67

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells
• Positive IHC detected in: human liver cancer tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

12615-1-AP targets NIFK in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3284

  Product name: Recombinant human MKI67IP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 5-293 aa of BC024238

  Sequence: SGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ

• Full Name: MKI67 (FHA domain) interacting nucleolar phosphoprotein
• Calculated Molecular Weight: 293 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC024238
• Gene Symbol: NIFK
• Gene ID (NCBI): 84365
• RRID: AB_2142384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	iScience; Multi-omics approach reveals posttranscriptionally regulated genes are essential for human pluripotent stem cells.; Authors - Mio Iwasaki
human	WB	Mol Cell; Alphavirus infection triggers selective cytoplasmic translocation of nuclear RBPs with moonlighting antiviral roles; Authors - Wael Kamel