Published Applications
| WB | See 2 publications below |
| IF | See 2 publications below |
Product Information
12183-1-AP targets MLC1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2829 Product name: Recombinant human MLC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC010518 Sequence: MHLWPGAIKIKEPGGLGDAAGWGGLQTLPGGLRTLPGFPLRNRSDSGCQDTFMVFMTSGIIIFNH Predict reactive species |
| Full Name | megalencephalic leukoencephalopathy with subcortical cysts 1 |
| Calculated Molecular Weight | 65 aa, 7 kDa |
| GenBank Accession Number | BC010518 |
| Gene Symbol | MLC1 |
| Gene ID (NCBI) | 23209 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15049 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MLC1, also named as KIAA0027 and WKL1, is a membrane protein which causes Megalencephalic leukoencephalopathy with subcortical cysts. MCL1 regulates the response of astrocytes to hypo-osmosis by promoting calcium influx.
Publications
| Species | Application | Title |
|---|---|---|
Int J Biol Macromol Proline rich-39 (PR-39) antimicrobial protein alleviated lipopolysaccharide-induced intestinal barrier dysfunction in piglets by altering intestinal flora associated bile acid metabolism and in turn regulating TGR-5/NF-κB/MLCK/MLC pathway | ||
J Med Virol Vaccinia virus induces EMT-like transformation and RhoA-mediated mesenchymal migration | ||
J Control Release Fluorinated chitosan mediated transepithelial delivery of sanguinarine-loaded platinum (IV) prodrug for intravesical instillation therapy of muscle-invasive bladder cancer |

